VIMSS330921 has 484 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-24 71.9 2.4 3.4e-24 71.4 2.4 1.3 1 VIMSS330921
Domain annotation for each sequence (and alignments):
>> VIMSS330921
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.4 2.4 3.4e-24 3.4e-24 1 78 [. 393 469 .. 393 470 .. 0.96
Alignments for each domain:
== domain 1 score: 71.4 bits; conditional E-value: 3.4e-24
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R++I++iD+++++Ll++R+e + +i+e+K++++lpvld++Re+ vl++++ + + ++++i+++i+++sra+Q
VIMSS330921 393 RQRINHIDQQIVRLLNQRFETVTAIGELKQQQQLPVLDQQREQRVLQQVAVKS-TQTAHTPYLQAIYQAIMHNSRAYQ 469
9*************************************************954.77899******************9 PP
Or compare VIMSS330921 to CDD or PaperBLAST