VIMSS3344194 has 92 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-16 46.8 0.5 1.9e-16 46.5 0.5 1.2 1 VIMSS3344194
Domain annotation for each sequence (and alignments):
>> VIMSS3344194
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 46.5 0.5 1.9e-16 1.9e-16 1 55 [. 20 74 .. 20 85 .. 0.91
Alignments for each domain:
== domain 1 score: 46.5 bits; conditional E-value: 1.9e-16
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaee 55
RkeId++D+e+l+ +++R+e+++ei++++ ++g p l +Re +vler e +e
VIMSS3344194 20 RKEIDRLDAEILAAIKRRTEVSREIGKARMASGGPRLVHSREMKVLERYSELGQE 74
9*************************************************94433 PP
Or compare VIMSS3344194 to CDD or PaperBLAST