VIMSS335361 has 74 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.1e-22 63.6 0.2 7.1e-22 63.4 0.2 1.1 1 VIMSS335361
Domain annotation for each sequence (and alignments):
>> VIMSS335361
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 63.4 0.2 7.1e-22 7.1e-22 1 48 [. 24 71 .. 24 72 .. 0.97
Alignments for each domain:
== domain 1 score: 63.4 bits; conditional E-value: 7.1e-22
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIk 48
p+v+t+++G +++t+++P++ +++G+ye+ed++Gk+++I+ d+V ++k
VIMSS335361 24 PSVVTLQNGTQYITKDMPKTKSRDGFYEFEDLSGKTIRIKADEVATVK 71
69********************************************98 PP
Or compare VIMSS335361 to CDD or PaperBLAST