PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS335361 to PF06004 (DUF903)

VIMSS335361 has 74 amino acids

Query:       DUF903  [M=49]
Accession:   PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.1e-22   63.6   0.2    7.1e-22   63.4   0.2    1.1  1  VIMSS335361  


Domain annotation for each sequence (and alignments):
>> VIMSS335361  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   63.4   0.2   7.1e-22   7.1e-22       1      48 [.      24      71 ..      24      72 .. 0.97

  Alignments for each domain:
  == domain 1  score: 63.4 bits;  conditional E-value: 7.1e-22
       DUF903  1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIk 48
                 p+v+t+++G +++t+++P++ +++G+ye+ed++Gk+++I+ d+V ++k
  VIMSS335361 24 PSVVTLQNGTQYITKDMPKTKSRDGFYEFEDLSGKTIRIKADEVATVK 71
                 69********************************************98 PP



Or compare VIMSS335361 to CDD or PaperBLAST