VIMSS33577 has 108 amino acids
Query: DUF732 [M=72]
Accession: PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-22 66.1 0.2 2.1e-22 65.7 0.2 1.1 1 VIMSS33577
Domain annotation for each sequence (and alignments):
>> VIMSS33577
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 65.7 0.2 2.1e-22 2.1e-22 1 71 [. 27 97 .. 26 98 .. 0.96
Alignments for each domain:
== domain 1 score: 65.7 bits; conditional E-value: 2.1e-22
DUF732 1 aDdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCP 71
+D+ Fla L++aG+ty+ pd+aia G++vC+ +++G+s +v+++l+++npg++ d f+++++++yCP
VIMSS33577 27 DDAVFLASLERAGITYSHPDQAIASGKAVCALVESGESGLQVVNELRTRNPGFSMDGCCKFAAISAHVYCP 97
4566******************************************************************* PP
Or compare VIMSS33577 to CDD or PaperBLAST