VIMSS3373103 has 224 amino acids
Query: DUF5981 [M=95]
Accession: PF12225.12
Description: Methylene-tetrahydrofolate reductase C terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.9e-42 126.9 4.0 9.9e-42 126.9 4.0 1.8 2 VIMSS3373103
Domain annotation for each sequence (and alignments):
>> VIMSS3373103
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.3 0.2 0.19 0.19 20 26 .. 25 31 .. 15 38 .. 0.65
2 ! 126.9 4.0 9.9e-42 9.9e-42 1 95 [] 110 204 .. 110 204 .. 0.99
Alignments for each domain:
== domain 1 score: -2.3 bits; conditional E-value: 0.19
DUF5981 20 ekCkaCg 26
C++C
VIMSS3373103 25 VGCNQCA 31
5566664 PP
== domain 2 score: 126.9 bits; conditional E-value: 9.9e-42
DUF5981 1 ypavntlflgveeevkvleekCkaCgeCvlaetggiCpvtrCpksllnGpCgGskngkCevkpekeCawvliyerlkklgrleklekivppkdws 95
ypa+ntlf+g+ ++v+++ee+CkaCg+C l++tggiCpvt+C+k+l+nG+CgG+kngkCev++e++Caw +iyerl+++g+l++l++i ppkd+s
VIMSS3373103 110 YPANNTLFIGEVQRVGEYEEACKACGDCELGWTGGICPVTMCAKGLMNGACGGAKNGKCEVNSENDCAWIKIYERLEAIGQLDNLAEIRPPKDYS 204
799******************************************************************************************85 PP
Or compare VIMSS3373103 to CDD or PaperBLAST