VIMSS3373103 has 224 amino acids
Query: DUF5981 [M=95]
Accession: PF12225.13
Description: Methylene-tetrahydrofolate reductase C terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7e-42 127.4 4.0 7e-42 127.4 4.0 1.8 2 VIMSS3373103
Domain annotation for each sequence (and alignments):
>> VIMSS3373103
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.4 0.3 0.21 0.21 20 26 .. 25 31 .. 16 38 .. 0.64
2 ! 127.4 4.0 7e-42 7e-42 1 95 [] 110 204 .. 110 204 .. 0.99
Alignments for each domain:
== domain 1 score: -2.4 bits; conditional E-value: 0.21
DUF5981 20 ekCkaCg 26
C++C
VIMSS3373103 25 VGCNQCA 31
4566664 PP
== domain 2 score: 127.4 bits; conditional E-value: 7e-42
DUF5981 1 ypavntlflgveeevkvleekCkaCgeCvlaetggiCpvtrCpksllnGpCgGskngkCevepekeCawvliyerlkklgrleklekivppkdws 95
ypa+ntlf+g+ ++v+++ee+CkaCg+C l++tggiCpvt+C+k+l+nG+CgG+kngkCev++e++Caw +iyerl+++g+l++l++i ppkd+s
VIMSS3373103 110 YPANNTLFIGEVQRVGEYEEACKACGDCELGWTGGICPVTMCAKGLMNGACGGAKNGKCEVNSENDCAWIKIYERLEAIGQLDNLAEIRPPKDYS 204
799******************************************************************************************95 PP
Or compare VIMSS3373103 to CDD or PaperBLAST