VIMSS3382792 has 79 amino acids
Query: DUF1480 [M=78]
Accession: PF07351.18
Description: Protein of unknown function (DUF1480)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-53 164.7 0.1 2.2e-53 164.6 0.1 1.0 1 VIMSS3382792
Domain annotation for each sequence (and alignments):
>> VIMSS3382792
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 164.6 0.1 2.2e-53 2.2e-53 1 78 [] 1 78 [. 1 78 [. 0.99
Alignments for each domain:
== domain 1 score: 164.6 bits; conditional E-value: 2.2e-53
DUF1480 1 msktklrisafeiddavlsseqkgertlsiPcksdpdlcmqldawdeetsiPailngkdsllyrkhydrqkdawvmrv 78
mskt++ri+afeidda+l++e++gertlsiPcksdpdlcmqldawd++ts+Pailng++s+lyrkhydrq+dawvmr+
VIMSS3382792 1 MSKTNVRIGAFEIDDAELHGEHQGERTLSIPCKSDPDLCMQLDAWDADTSVPAILNGEHSVLYRKHYDRQSDAWVMRL 78
99**************************************************************************97 PP
Or compare VIMSS3382792 to CDD or PaperBLAST