VIMSS3383360 has 386 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.7e-23 66.9 1.4 1.6e-22 66.1 1.4 1.4 1 VIMSS3383360
Domain annotation for each sequence (and alignments):
>> VIMSS3383360
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.1 1.4 1.6e-22 1.6e-22 1 79 [] 11 89 .. 11 89 .. 0.98
Alignments for each domain:
== domain 1 score: 66.1 bits; conditional E-value: 1.6e-22
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R++I ++D++ll+LlaeR la e++++K +++ pv+d +Re+++lerl+ ++++ld+++++++f+ ii+ s+ Q+
VIMSS3383360 11 RDKISALDEKLLALLAERRGLAVEVGKAKLASHRPVRDIDRERDLLERLMTIGKRHNLDAHYITRLFQLIIEDSVLTQQ 89
99*************************************************999********************99985 PP
Or compare VIMSS3383360 to CDD or PaperBLAST