VIMSS338369 has 71 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.16
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.3e-14 37.6 3.2 9.4e-14 37.2 3.2 1.2 1 VIMSS338369
Domain annotation for each sequence (and alignments):
>> VIMSS338369
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 37.2 3.2 9.4e-14 9.4e-14 1 37 [] 26 62 .. 26 62 .. 0.95
Alignments for each domain:
== domain 1 score: 37.2 bits; conditional E-value: 9.4e-14
DUF1127 1 lraalrrWrryRrtrreLarLsDreLaDIGLsRsdir 37
++a+l W+r+ +r++LarL+ r+LaD G+s+s+++
VIMSS338369 26 VFANLMLWQRRLSSRHQLARLDSRLLADAGISESQRY 62
5799******************************985 PP
Or compare VIMSS338369 to CDD or PaperBLAST