VIMSS339059 has 375 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-29 87.8 2.0 3e-29 87.6 0.9 1.7 2 VIMSS339059 Domain annotation for each sequence (and alignments): >> VIMSS339059 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.6 0.9 3e-29 3e-29 1 78 [. 9 86 .. 9 87 .. 0.98 2 ? -2.8 0.0 0.5 0.5 11 32 .. 316 337 .. 314 347 .. 0.72 Alignments for each domain: == domain 1 score: 87.6 bits; conditional E-value: 3e-29 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78 R++Id++D+++leLla+R+el+++++e+K+e+glp++ p+Re+++l+ +r++ae++g++p+++e+i+r+ ++es a + VIMSS339059 9 RDQIDAVDKQMLELLAQRLELVEKVGEVKSEHGLPIYAPDREAAMLASRRAEAEKMGVPPQLIEDILRRTMRESYASE 86 99************************************************************************9987 PP == domain 2 score: -2.8 bits; conditional E-value: 0.5 CM_2 11 lleLlaeRmelakeiaeyKken 32 +++ + +R+ a +i K ++ VIMSS339059 316 MIKRFHQRFGEALAILDSKDKA 337 6777888888888888887544 PP
Or compare VIMSS339059 to CDD or PaperBLAST