VIMSS339516 has 54 amino acids
Query: DUF2496 [M=43]
Accession: PF10689.13
Description: Protein of unknown function (DUF2496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.7e-28 82.4 4.1 8.9e-28 82.2 4.1 1.0 1 VIMSS339516
Domain annotation for each sequence (and alignments):
>> VIMSS339516
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.2 4.1 8.9e-28 8.9e-28 1 43 [] 8 50 .. 8 50 .. 0.99
Alignments for each domain:
== domain 1 score: 82.2 bits; conditional E-value: 8.9e-28
DUF2496 1 sLenApeevkLAVDLImLLEsnqiepevalaALeIVkrDfekK 43
+L++Apee+kLAVDLI+LLE+n+i+peva++AL+IV++D+e+K
VIMSS339516 8 PLDDAPEEIKLAVDLIYLLETNEIDPEVAIKALKIVQTDLENK 50
8*****************************************9 PP
Or compare VIMSS339516 to CDD or PaperBLAST