VIMSS339793 has 64 amino acids
Query: TIGR00001 [M=63]
Accession: TIGR00001
Description: rpmI_bact: ribosomal protein bL35
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8e-31 92.5 5.2 8.7e-31 92.3 5.2 1.0 1 VIMSS339793
Domain annotation for each sequence (and alignments):
>> VIMSS339793
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 92.3 5.2 8.7e-31 8.7e-31 1 63 [] 2 63 .. 2 63 .. 0.98
Alignments for each domain:
== domain 1 score: 92.3 bits; conditional E-value: 8.7e-31
TIGR00001 1 pKmKTkkaaaKRFkvtgsGkikrkkagkrHlltkKsskrkRqLrkkalvsksdlkrvkllLpy 63
pKmKT+k+aaKRFk+t+ G ik+k+a+krH+ltk+++k+kRqLr +a++ ++++++v+++Lpy
VIMSS339793 2 PKMKTNKGAAKRFKKTAGG-IKYKHATKRHILTKRTTKNKRQLRPNAILPRCEVAAVIRMLPY 63
9***************777.******************************************8 PP
Or compare VIMSS339793 to CDD or PaperBLAST