VIMSS339799 has 263 amino acids
Query: DUF1329 [M=368] Accession: PF07044.18 Description: Protein of unknown function (DUF1329) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-16 47.1 1.1 9.5e-10 24.3 1.1 2.2 2 VIMSS339799 Domain annotation for each sequence (and alignments): >> VIMSS339799 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.4 0.0 7e-09 7e-09 147 212 .. 85 145 .. 13 154 .. 0.84 2 ! 24.3 1.1 9.5e-10 9.5e-10 258 342 .. 157 240 .. 146 260 .. 0.76 Alignments for each domain: == domain 1 score: 21.4 bits; conditional E-value: 7e-09 DUF1329 147 vtaParlaGeallvhetldqvkeprqawlYlpgqRRVRraPtlayDtpqaaadglrtlDdldmfnG 212 + +P +++G+a+l+h+ ++ + wlYlp+ +RV+r+++ ++++++ ++dl+ f+ VIMSS339799 85 FDQPRDVTGTAFLNHSHTIGAD---DQWLYLPALKRVKRISSRNKS--GPFMGSEFAYEDLSSFEI 145 789************9887777...89*************998765..688888888888888864 PP == domain 2 score: 24.3 bits; conditional E-value: 9.5e-10 DUF1329 258 ryelhrVwvveAtlkegkrhiysKrvfYlDedswqilaadqYDarGeLwrvseahlinaydvpagwstlevlyDlqsgrytvdgl 342 ++ V+v+e + ++ + y K+v++lD +++l ++ YD++G L ++ ++++y + + ++++ + q+g+ t ++ VIMSS339799 157 KFNGQDVFVLEQIPTDK-NSGYTKQVVWLDKAHYRPLKVEFYDRKGALLKTLTFANYKQYLDKYWRAHTMAMTNHQTGKSTELNT 240 67778999999888866.99******************************54444444444444445888999999999885554 PP
Or compare VIMSS339799 to CDD or PaperBLAST