VIMSS34068 has 212 amino acids
Query: UPF0167 [M=177] Accession: PF03691.18 Description: Uncharacterised protein family (UPF0167) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-70 222.0 0.0 2.9e-70 221.8 0.0 1.0 1 VIMSS34068 Domain annotation for each sequence (and alignments): >> VIMSS34068 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.8 0.0 2.9e-70 2.9e-70 1 177 [] 37 211 .. 37 211 .. 0.98 Alignments for each domain: == domain 1 score: 221.8 bits; conditional E-value: 2.9e-70 UPF0167 1 LpeFkYhpdplktgaieeeevkCqcCgkereviytspfysvedv.ealCpwCiadGsaakkfegefqddaslveleeideelleellertpgyisWqqe 98 Lp+F+Yhpdp+ tg+i+++ev+C +C+++r ++yt+p+y++e++ ea+CpwCiadGsaa++f+++f+d +++v ++++e+++ee+l+rtpg+++W qe VIMSS34068 37 LPQFRYHPDPVGTGSIVADEVSCVSCEQRRPYTYTGPVYAEEELnEAICPWCIADGSAASRFDATFTDAMWAVP-DDVPEDVTEEVLCRTPGFTGWLQE 134 8*******************************************99**************************88.9*********************** PP UPF0167 99 qWlahCgdacaflgevgakelkaleealekeeleeilddlersadkveellkalekegeltaylFrClhcgkhrlyiDa 177 +Wl+hCgda+aflg vga+e+++l++al++ l++ +++++++adk+ee++ +l+++g +taylFrCl+cg h++y+D+ VIMSS34068 135 EWLHHCGDAAAFLGPVGASEVADLPDALDA--LRNEYRGYDWPADKIEEFILTLDRNGLATAYLFRCLSCGVHLAYADF 211 **************************9998..79999999999**********************************97 PP
Or compare VIMSS34068 to CDD or PaperBLAST