PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS340938 to PF06568 (DUF1127)

VIMSS340938 has 69 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.4e-16   45.6   0.5    2.4e-16   45.6   0.5    1.4  2  VIMSS340938  


Domain annotation for each sequence (and alignments):
>> VIMSS340938  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.2   0.1      0.41      0.41      12      18 ..      16      22 ..      15      22 .. 0.66
   2 !   45.6   0.5   2.4e-16   2.4e-16       2      37 .]      24      59 ..      23      59 .. 0.94

  Alignments for each domain:
  == domain 1  score: -3.2 bits;  conditional E-value: 0.41
      DUF1127 12 RrtrreL 18
                 R+t+ +L
  VIMSS340938 16 RQTWLQL 22
                 7777666 PP

  == domain 2  score: 45.6 bits;  conditional E-value: 2.4e-16
      DUF1127  2 raalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
                 +++l  Wrr++rtrr+L +L++++++DIGL+  +ir
  VIMSS340938 24 YSKLVVWRRNYRTRRHLKDLPEHLWDDIGLEANEIR 59
                 678999****************************97 PP



Or compare VIMSS340938 to CDD or PaperBLAST