VIMSS341632 has 117 amino acids
Query: DUF413 [M=90]
Accession: PF04219.16
Description: Protein of unknown function, DUF
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.6e-40 122.2 0.2 4.3e-40 121.9 0.2 1.1 1 VIMSS341632
Domain annotation for each sequence (and alignments):
>> VIMSS341632
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 121.9 0.2 4.3e-40 4.3e-40 1 90 [] 12 101 .. 12 101 .. 0.99
Alignments for each domain:
== domain 1 score: 121.9 bits; conditional E-value: 4.3e-40
DUF413 1 rFyDdknfprGfsrsGdFtikeaelLeqyGqalkaLeegelepvteeekqfvevvkgekaaeselekvWlkYlklirgkkrfhtlvgtkk 90
rFyD+ +fprGf++sGdFt++e+e+L+ yG+++ +Le+gel+p+++eek+fv+v+++ +a++++e++WlkY++l+rg+krfhtl+g++k
VIMSS341632 12 RFYDNVKFPRGFAKSGDFTLSEEEILTIYGDTMLGLESGELTPENSEEKHFVKVLENPGKAKTKIERTWLKYTQLARGRKRFHTLNGRNK 101
8*************************************************************************************9975 PP
Or compare VIMSS341632 to CDD or PaperBLAST