VIMSS34511 has 68 amino acids
Query: DUF3046 [M=62]
Accession: PF11248.12
Description: Protein of unknown function (DUF3046)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-32 98.5 0.1 1.3e-32 98.3 0.1 1.0 1 VIMSS34511
Domain annotation for each sequence (and alignments):
>> VIMSS34511
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 98.3 0.1 1.3e-32 1.3e-32 1 61 [. 5 65 .. 5 66 .. 0.98
Alignments for each domain:
== domain 1 score: 98.3 bits; conditional E-value: 1.3e-32
DUF3046 1 MRlteFwelveeeFGsayaeslardhvlselggrTaeeAleaGvdprdVWralcdafdvPe 61
+RlteF+e+v+ +FG+ay++s++ dhvl++++gr+a++A+e+Gv+prdVWralc++fdvP+
VIMSS34511 5 VRLTEFHERVALHFGAAYGSSVLLDHVLTGFDGRSAAQAIEDGVEPRDVWRALCADFDVPH 65
59**********************************************************7 PP
Or compare VIMSS34511 to CDD or PaperBLAST