PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS346432 to PF07869 (DUF1656)

VIMSS346432 has 78 amino acids

Query:       DUF1656  [M=56]
Accession:   PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.5e-19   54.1   4.2    9.9e-19   53.5   4.2    1.3  1  VIMSS346432  


Domain annotation for each sequence (and alignments):
>> VIMSS346432  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   53.5   4.2   9.9e-19   9.9e-19       5      56 .]      19      70 ..      16      70 .. 0.97

  Alignments for each domain:
  == domain 1  score: 53.5 bits;  conditional E-value: 9.9e-19
      DUF1656  5 gGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
                 + vy+pp++ +++l++v++l ++rll++  ++  +Whp L+dl+lf ++++l
  VIMSS346432 19 ASVYFPPFFKAFALGFVIWLFIHRLLRDRIYSDEIWHPLLMDLSLFTLCVCL 70
                 68***********************************************996 PP



Or compare VIMSS346432 to CDD or PaperBLAST