VIMSS346432 has 78 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.5e-19 54.1 4.2 9.9e-19 53.5 4.2 1.3 1 VIMSS346432
Domain annotation for each sequence (and alignments):
>> VIMSS346432
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 53.5 4.2 9.9e-19 9.9e-19 5 56 .] 19 70 .. 16 70 .. 0.97
Alignments for each domain:
== domain 1 score: 53.5 bits; conditional E-value: 9.9e-19
DUF1656 5 gGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
+ vy+pp++ +++l++v++l ++rll++ ++ +Whp L+dl+lf ++++l
VIMSS346432 19 ASVYFPPFFKAFALGFVIWLFIHRLLRDRIYSDEIWHPLLMDLSLFTLCVCL 70
68***********************************************996 PP
Or compare VIMSS346432 to CDD or PaperBLAST