VIMSS347384 has 269 amino acids
Query: DUF2877 [M=109]
Accession: PF11392.12
Description: Protein of unknown function (DUF2877)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-32 98.5 0.1 3.1e-32 97.7 0.1 1.4 1 VIMSS347384
Domain annotation for each sequence (and alignments):
>> VIMSS347384
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 97.7 0.1 3.1e-32 3.1e-32 1 108 [. 158 263 .. 158 264 .. 0.97
Alignments for each domain:
== domain 1 score: 97.7 bits; conditional E-value: 3.1e-32
DUF2877 1 lvGlGpGlTPsgDDflvGllaalallgakaakseaelleevaaaekkttdvSaalLraAlegevsesllallkalssedeeelakaieellaiGhtSG 98
++G GpGlTPs+ D+l+G+l+a +++ga ++++ ++++++ + + tt vS ++Lr+A++g+++++ll++++al +++++ ++ai+ lla+GhtSG
VIMSS347384 158 WLGKGPGLTPSHEDTLTGMLLAAWYFGAIDERAGRNFFAQSGSLDRATTLVSVSYLRYAAMGYFASPLLHFIHALRRDART--ETAIDGLLALGHTSG 253
68**************************************99**********************************98887..9************** PP
DUF2877 99 adlllGlllg 108
ad+llG++lg
VIMSS347384 254 ADTLLGFWLG 263
*******997 PP
Or compare VIMSS347384 to CDD or PaperBLAST