VIMSS347890 has 109 amino acids
Query: DUF446 [M=98]
Accession: PF04287.16
Description: tRNA pseudouridine synthase C
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-38 115.8 3.0 4.3e-38 115.6 3.0 1.0 1 VIMSS347890
Domain annotation for each sequence (and alignments):
>> VIMSS347890
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 115.6 3.0 4.3e-38 4.3e-38 2 98 .] 7 103 .. 6 103 .. 0.98
Alignments for each domain:
== domain 1 score: 115.6 bits; conditional E-value: 4.3e-38
DUF446 2 vaelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwvfiprmkalieaeqpLPkavaiapmaeealkeeeeekeellallkelDel 98
v+++L++le+ Lre+++W+ +ap+++ ++st+PF++dt+e+ eWLqwv+iprm++l+++ qpLP+a+a+ap++e+al++++ ++e++la+l++lD+l
VIMSS347890 7 VRQQLHALETLLREHRHWRLDAPQAHLFTSTQPFFMDTMEPLEWLQWVLIPRMHTLLDNAQPLPEAFAVAPYYEMALAADHPQREAILAVLQDLDAL 103
799********************************************************************************************86 PP
Or compare VIMSS347890 to CDD or PaperBLAST