VIMSS3480869 has 105 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-39 121.0 5.7 1.4e-39 120.7 5.7 1.1 1 VIMSS3480869
Domain annotation for each sequence (and alignments):
>> VIMSS3480869
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 120.7 5.7 1.4e-39 1.4e-39 1 79 [] 27 104 .. 27 104 .. 0.98
Alignments for each domain:
== domain 1 score: 120.7 bits; conditional E-value: 1.4e-39
DUF4212 1 akaYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrkygve 79
akaYw +n++l+++l+viWf+vsfg+gilf++eln+++ ++g++lgFwfa+qgsi++f+ +if+Ya++m+++Dr++gv+
VIMSS3480869 27 AKAYWDKNVKLMITLMVIWFVVSFGCGILFVDELNQFQ-LGGYKLGFWFAQQGSIYAFLGIIFYYAWKMRQIDREFGVD 104
589**********************************6.**************************************96 PP
Or compare VIMSS3480869 to CDD or PaperBLAST