VIMSS34840 has 136 amino acids
Query: DUF732 [M=72] Accession: PF05305.18 Description: Protein of unknown function (DUF732) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-20 59.5 0.0 3.2e-20 58.7 0.0 1.3 1 VIMSS34840 Domain annotation for each sequence (and alignments): >> VIMSS34840 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.7 0.0 3.2e-20 3.2e-20 2 72 .] 58 127 .. 56 127 .. 0.94 Alignments for each domain: == domain 1 score: 58.7 bits; conditional E-value: 3.2e-20 DUF732 2 DdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72 D Fl L++ G+++t+pdaa+ G+ vC+ L G+++++v+ al++s+p l + a+++ ++i++yCP+ VIMSS34840 58 DSVFLGNLHDRGISFTNPDAAVYNGKMVCTNLGGGMTVQQVVEALQSSSPALGDRTTAYVA-VSIRTYCPK 127 667*********************************************9999999996666.********5 PP
Or compare VIMSS34840 to CDD or PaperBLAST