VIMSS350671 has 66 amino acids
Query: DUF2492 [M=77]
Accession: PF10678.13
Description: Protein of unknown function (DUF2492)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-28 85.2 0.1 1.7e-28 85.1 0.1 1.0 1 VIMSS350671
Domain annotation for each sequence (and alignments):
>> VIMSS350671
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 85.1 0.1 1.7e-28 1.7e-28 11 77 .] 1 65 [. 1 65 [. 0.97
Alignments for each domain:
== domain 1 score: 85.1 bits; conditional E-value: 1.7e-28
DUF2492 11 lllasgesltrasLkeaieekFGeearFhtCsaedltaeeLiefLlkkgKfiesedglttnaekiCn 77
++ +g+s+t+asL++ai ekFGe++rF+tCsa++++++eLi fL++kgKf+++ + +t++ +k+C+
VIMSS350671 1 MM--EGNSYTEASLRAAIVEKFGEHQRFYTCSADNMEVDELIGFLKRKGKFMPAGEEFTVDISKVCS 65
55..99************************************************************6 PP
Or compare VIMSS350671 to CDD or PaperBLAST