VIMSS353512 has 384 amino acids
Query: DUF1735 [M=120] Accession: PF08522.14 Description: Domain of unknown function (DUF1735) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-22 66.8 3.4 3.6e-22 65.5 3.4 1.7 1 VIMSS353512 Domain annotation for each sequence (and alignments): >> VIMSS353512 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.5 3.4 3.6e-22 3.6e-22 1 119 [. 32 149 .. 32 150 .. 0.87 Alignments for each domain: == domain 1 score: 65.5 bits; conditional E-value: 3.6e-22 DUF1735 1 ydnkvyieeaspsktltldeeelgdettislsvtvsgsspkdvtvtlevdeslldeYnkangtnykllPedsytlessevtikaGsvssapvkiklkd 98 ydnk+y+++a ++l ++ +++ + + ls +++ + ++d+++++ + +++ ++Yn ++ n ++l++ y++++++ tikaG++ss+++ i++k+ VIMSS353512 32 YDNKLYVSSAPVCDDLLIKPSITEATRE--LSYRIASPAEQDIQISFDAAPAMTAAYNLIYNDNATALDSYFYNMPTKTATIKAGDISSDNIVIDFKN 127 6777788744445577777775555555..7888888888********************************************************** PP DUF1735 99 ldkld.gktYvlPlritsvsge 119 +++ld +k YvlP++i ++s+ VIMSS353512 128 TNELDkSKRYVLPVTILDASNI 149 999999***********99985 PP
Or compare VIMSS353512 to CDD or PaperBLAST