VIMSS354678 has 171 amino acids
Query: DUF308 [M=73] Accession: PF03729.17 Description: Short repeat of unknown function (DUF308) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-24 70.7 32.2 1.5e-13 37.2 9.5 3.0 3 VIMSS354678 Domain annotation for each sequence (and alignments): >> VIMSS354678 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.2 9.5 1.5e-13 1.5e-13 5 73 .] 19 86 .. 18 86 .. 0.92 2 ! 17.5 9.5 2.1e-07 2.1e-07 1 48 [. 72 119 .. 72 124 .. 0.91 3 ! 34.6 5.9 9.7e-13 9.7e-13 2 47 .. 125 170 .. 124 171 .] 0.94 Alignments for each domain: == domain 1 score: 37.2 bits; conditional E-value: 1.5e-13 DUF308 5 lliilGilaliwPgaallalviliGvlllvsGivqlvaafaarkkegggfw.llllsGilyiiaGllllf 73 ++i++G +++++Pga++ ++ +li+ +l++ G+++++ ++ +k++g+ w l ++ G++++++++ +lf VIMSS354678 19 VFIVIGSAIVFNPGAFFQFVGYLIAGYLMLLGLINIYDDYKIKKQTGS--WgLGFVTGLIFVVLAVAFLF 86 79**************************************88886665..44799*************97 PP == domain 2 score: 17.5 bits; conditional E-value: 2.1e-07 DUF308 1 llGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaark 48 ++G+++++l++++l++ + + +l +l+G+ +++ G+vql a+ +r+ VIMSS354678 72 VTGLIFVVLAVAFLFFAPVIVSILPFLLGISIVINGLVQLTFALNTRQ 119 68**************************************98886665 PP == domain 3 score: 34.6 bits; conditional E-value: 9.7e-13 DUF308 2 lGilliilGilaliwPgaallalviliGvlllvsGivqlvaafaar 47 +il +i+G++++++P+ +ll+l+ ++G++l++ G++++++ f+++ VIMSS354678 125 YSILVLIAGAVLVFNPFKSLLVLMQVFGFILIFMGVIEIIGHFRNK 170 68**************************************999655 PP
Or compare VIMSS354678 to CDD or PaperBLAST