VIMSS355299 has 261 amino acids
Query: AadA_C [M=103]
Accession: PF13427.10
Description: Aminoglycoside adenylyltransferase, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-36 111.2 0.0 2.1e-36 110.5 0.0 1.3 1 VIMSS355299
Domain annotation for each sequence (and alignments):
>> VIMSS355299
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 110.5 0.0 2.1e-36 2.1e-36 2 101 .. 157 256 .. 156 257 .. 0.98
Alignments for each domain:
== domain 1 score: 110.5 bits; conditional E-value: 2.1e-36
AadA_C 2 vldpvpredlvdailadveelleeieederyvvLtLaRvlatletgeilsKdeAaewalerlPeeyrpllaeArkaylgeeeekweedeeeveefaky 99
v++++++++++++i+adv+e+++ei ++++yv+L+++Rv+a++++++ilsK++++ew+l ++P+++++l++ A+k+y+ge+ +++++e+++fa++
VIMSS355299 157 VFGWIDQKKYFESIVADVKEAKKEIVQQPMYVILNMCRVMAFKQENKILSKRAGGEWGLVHFPTNHHSLIQLALKEYRGETVLLEQYNDSELNDFADI 254
9************************************************************************************************* PP
AadA_C 100 ml 101
ml
VIMSS355299 255 ML 256
98 PP
Or compare VIMSS355299 to CDD or PaperBLAST