VIMSS355319 has 101 amino acids
Query: DUF898 [M=336] Accession: PF05987.17 Description: Bacterial protein of unknown function (DUF898) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-18 52.9 9.6 3.4e-14 38.7 4.7 2.0 2 VIMSS355319 Domain annotation for each sequence (and alignments): >> VIMSS355319 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.8 0.2 1.6e-07 1.6e-07 123 164 .. 6 47 .. 3 51 .. 0.73 2 ! 38.7 4.7 3.4e-14 3.4e-14 3 48 .. 53 98 .. 51 100 .. 0.95 Alignments for each domain: == domain 1 score: 16.8 bits; conditional E-value: 1.6e-07 DUF898 123 fdgslaeaykaflllpllalltlglllPlaearqkrylvnnt 164 fdg la+++ ++l+ l++++tlg+ +P+ +++++ +++t VIMSS355319 6 FDGGLATYIGTSILATLITVFTLGICAPWGICMMYNWKIKHT 47 777777788888888888888888888887777777766665 PP == domain 2 score: 38.7 bits; conditional E-value: 3.4e-14 DUF898 3 rvaFtGsggeyfriwivNllLtivTLGiYsaWakvrtrrYfygnTr 48 r+ F+G++ ++f+ wi llLti+TLGiY +W r +++ ++T VIMSS355319 53 RLYFDGTAMQLFGHWIKWLLLTIITLGIYGFWLNIRLQQWITKHTH 98 788**************************************99996 PP
Or compare VIMSS355319 to CDD or PaperBLAST