VIMSS35859 has 78 amino acids
Query: DUF1674 [M=50]
Accession: PF07896.16
Description: Protein of unknown function (DUF1674)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-16 46.9 0.1 1.7e-16 46.7 0.1 1.1 1 VIMSS35859
Domain annotation for each sequence (and alignments):
>> VIMSS35859
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 46.7 0.1 1.7e-16 1.7e-16 21 50 .] 49 78 .] 34 78 .] 0.84
Alignments for each domain:
== domain 1 score: 46.7 bits; conditional E-value: 1.7e-16
DUF1674 21 npktgEigGpkgpEPtRygDWerkGrvsDF 50
k +EigG kg+EPtRygDW kG v+DF
VIMSS35859 49 LSKEKEIGGIKGLEPTRYGDWQHKGKVTDF 78
45679************************* PP
Or compare VIMSS35859 to CDD or PaperBLAST