VIMSS3608047 has 165 amino acids
Query: DUF454 [M=115] Accession: PF04304.17 Description: Protein of unknown function (DUF454) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-36 111.3 4.3 1.6e-36 111.1 4.3 1.0 1 VIMSS3608047 Domain annotation for each sequence (and alignments): >> VIMSS3608047 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.1 4.3 1.6e-36 1.6e-36 1 114 [. 13 126 .. 13 127 .. 0.97 Alignments for each domain: == domain 1 score: 111.1 bits; conditional E-value: 1.6e-36 DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwvki 97 r l+ ++G++sla G +G+vlP+LPTtpF++l afcfa++ prl ++L +h +fgp+i +wr++rai +++v+a l+m ++l++sl+ s v + VIMSS3608047 13 RPLWAAAGVVSLATGSVGAVLPVLPTTPFMILGAFCFAKGAPRLAQRLEQHGIFGPMIAEWRAHRAIAPRVRVVAHLMMGAALVLSLVAGVSGPVLA 109 679**************************************************************************************99999999 PP DUF454 98 llalvlllvllyllrlp 114 + +++ll+ ++y+l++p VIMSS3608047 110 VQMTCLLGASAYILSRP 126 999**********9998 PP
Or compare VIMSS3608047 to CDD or PaperBLAST