VIMSS3626225 has 396 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.7e-23 66.9 2.0 1.7e-22 66.0 2.0 1.5 1 VIMSS3626225
Domain annotation for each sequence (and alignments):
>> VIMSS3626225
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.0 2.0 1.7e-22 1.7e-22 1 79 [] 21 99 .. 21 99 .. 0.97
Alignments for each domain:
== domain 1 score: 66.0 bits; conditional E-value: 1.7e-22
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R +I ++D++ll+LlaeR +la e++++K +++ pv+d +Re+++lerl + ++++ld+++++++f+ ii+ s+ Q+
VIMSS3626225 21 RVKISALDEKLLALLAERRALAVEVGKAKLDSHRPVRDIDRERDLLERLIQLGKAHHLDAHYITRLFQLIIEDSVLTQQ 99
889************************************************9999*******************99985 PP
Or compare VIMSS3626225 to CDD or PaperBLAST