VIMSS3626431 has 72 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.6e-29 85.8 3.6 8.8e-29 85.6 3.6 1.1 1 VIMSS3626431
Domain annotation for each sequence (and alignments):
>> VIMSS3626431
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 85.6 3.6 8.8e-29 8.8e-29 1 49 [] 23 71 .. 23 71 .. 0.98
Alignments for each domain:
== domain 1 score: 85.6 bits; conditional E-value: 8.8e-29
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIke 49
+yv++TkDG++i+t+gkPe+D+dtG+++Y d++G+++qIn+ddV+qI+e
VIMSS3626431 23 DYVMATKDGRMILTDGKPEVDDDTGLVSYNDQQGNKMQINRDDVSQIIE 71
6**********************************************98 PP
Or compare VIMSS3626431 to CDD or PaperBLAST