VIMSS3628325 has 107 amino acids
Query: UPF0227 [M=187] Accession: PF05728.16 Description: Uncharacterised protein family (UPF0227) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-12 34.6 0.2 3.2e-10 26.4 0.0 2.1 2 VIMSS3628325 Domain annotation for each sequence (and alignments): >> VIMSS3628325 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.4 0.0 3.2e-10 3.2e-10 63 94 .. 2 33 .. 1 55 [. 0.89 2 ! 7.0 0.0 0.00028 0.00028 141 172 .. 56 88 .. 40 101 .. 0.80 Alignments for each domain: == domain 1 score: 26.4 bits; conditional E-value: 3.2e-10 UPF0227 63 lvGssLGGyyatrlgerfglrqvllnPalkpe 94 lvG sLGGy+a +++++l+ ++ nP l+p+ VIMSS3628325 2 LVGHSLGGYWALKTAAQHKLAVIVANPSLTPN 33 9****************************996 PP == domain 2 score: 7.0 bits; conditional E-value: 0.00028 UPF0227 141 lskqDevldyrravaeyraaaeiveddg.dHkf 172 l+ +De ld+ + +++++++++i dg H + VIMSS3628325 56 LELGDEQLDMYQVQEKLSPYMTIETYDGgHHRL 88 5679*****************997766647766 PP
Or compare VIMSS3628325 to CDD or PaperBLAST