VIMSS3629412 has 165 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-16 44.8 0.3 2.4e-15 43.0 0.1 1.9 2 VIMSS3629412 Domain annotation for each sequence (and alignments): >> VIMSS3629412 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.0 0.1 2.4e-15 2.4e-15 12 79 .] 16 83 .. 13 83 .. 0.96 2 ? -0.7 0.0 0.11 0.11 1 15 [. 106 120 .. 106 131 .. 0.79 Alignments for each domain: == domain 1 score: 43.0 bits; conditional E-value: 2.4e-15 CM_2 12 leLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 +L++eR++++k++a yK+e++lp+ d +e++vl++ ++a++ gl+ e+v+ ++ + ++ +a+Q+ VIMSS3629412 16 ARLINERLSYMKDVAGYKAEQHLPIEDLTQEKKVLDQSLSEADAFGLNSETVKPFIVAQMDVAKAIQY 83 68***************************************************************996 PP == domain 2 score: -0.7 bits; conditional E-value: 0.11 CM_2 1 RkeIdeiDrelleLl 15 R +I +++ ell+ + VIMSS3629412 106 RVKISALNTELLKNI 120 678888888888766 PP
Or compare VIMSS3629412 to CDD or PaperBLAST