VIMSS3630033 has 95 amino acids
Query: DUF493 [M=84] Accession: PF04359.20 Description: Protein of unknown function (DUF493) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-28 84.9 0.0 2.6e-28 84.8 0.0 1.0 1 VIMSS3630033 Domain annotation for each sequence (and alignments): >> VIMSS3630033 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.8 0.0 2.6e-28 2.6e-28 2 84 .] 13 95 .] 12 95 .] 0.97 Alignments for each domain: == domain 1 score: 84.8 bits; conditional E-value: 2.6e-28 DUF493 2 elleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84 +l+ FP+d+pik iG+a+ee++ avv+++ +h+p+fd+++++v++S++gkY+S+t++++ ++ eq++a+y++L a+++++ +L VIMSS3630033 13 DLWVFPMDYPIKLIGDAGEELRIAVVDILVKHFPDFDQTTLKVQESRTGKYHSLTAQLRFDELEQVHALYADLAACPQIRTAL 95 6899***************************************************************************9876 PP
Or compare VIMSS3630033 to CDD or PaperBLAST