PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3630033 to PF04359 (DUF493)

VIMSS3630033 has 95 amino acids

Query:       DUF493  [M=84]
Accession:   PF04359.20
Description: Protein of unknown function (DUF493)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.3e-28   84.9   0.0    2.6e-28   84.8   0.0    1.0  1  VIMSS3630033  


Domain annotation for each sequence (and alignments):
>> VIMSS3630033  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   84.8   0.0   2.6e-28   2.6e-28       2      84 .]      13      95 .]      12      95 .] 0.97

  Alignments for each domain:
  == domain 1  score: 84.8 bits;  conditional E-value: 2.6e-28
        DUF493  2 elleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84
                  +l+ FP+d+pik iG+a+ee++ avv+++ +h+p+fd+++++v++S++gkY+S+t++++ ++ eq++a+y++L a+++++ +L
  VIMSS3630033 13 DLWVFPMDYPIKLIGDAGEELRIAVVDILVKHFPDFDQTTLKVQESRTGKYHSLTAQLRFDELEQVHALYADLAACPQIRTAL 95
                  6899***************************************************************************9876 PP



Or compare VIMSS3630033 to CDD or PaperBLAST