VIMSS3630148 has 113 amino acids
Query: DUF1508 [M=48] Accession: PF07411.16 Description: Domain of unknown function (DUF1508) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-48 146.3 6.2 1.1e-25 75.6 0.8 2.0 2 VIMSS3630148 Domain annotation for each sequence (and alignments): >> VIMSS3630148 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.6 0.8 1.1e-25 1.1e-25 1 48 [] 10 57 .. 10 57 .. 0.98 2 ! 74.0 0.5 3.4e-25 3.4e-25 1 48 [] 61 108 .. 61 108 .. 0.98 Alignments for each domain: == domain 1 score: 75.6 bits; conditional E-value: 1.1e-25 DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48 +++G++rF+Lka+Nge+I++se Y++ka+a ngIesV+kn++d++++D VIMSS3630148 10 ANDGQYRFVLKAGNGEIILNSELYKAKASAVNGIESVQKNSSDDARYD 57 589*******************************************98 PP == domain 2 score: 74.0 bits; conditional E-value: 3.4e-25 DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48 +knGk++F+LkaaN+++I++s+ Y+s+a++++gIesVk+n+++++++D VIMSS3630148 61 AKNGKPYFNLKAANHQIIGSSQFYASEASRDKGIESVKNNGSSTTIKD 108 69********************************************98 PP
Or compare VIMSS3630148 to CDD or PaperBLAST