VIMSS3630382 has 69 amino acids
Query: DUF2387 [M=72] Accession: PF09526.16 Description: Probable metal-binding protein (DUF2387) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-19 55.8 0.4 2.1e-19 55.7 0.4 1.2 1 VIMSS3630382 Domain annotation for each sequence (and alignments): >> VIMSS3630382 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.7 0.4 2.1e-19 2.1e-19 1 45 [. 1 45 [. 1 62 [. 0.91 Alignments for each domain: == domain 1 score: 55.7 bits; conditional E-value: 2.1e-19 DUF2387 1 ikKRFiAGAVCPaCseqDklvmykedeveirECvaCgfvdklnek 45 +kKRFiAGA CP+C D++vm e e EC++Cg+++++ ++ VIMSS3630382 1 MKKRFIAGAKCPKCEAIDRIVMLTTAEDEWIECIECGYSENRPTH 45 79*************************************998655 PP
Or compare VIMSS3630382 to CDD or PaperBLAST