VIMSS3630569 has 137 amino acids
Query: DUF805 [M=111] Accession: PF05656.20 Description: Protein of unknown function (DUF805) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-21 62.5 2.1 1.8e-20 59.7 0.1 2.0 2 VIMSS3630569 Domain annotation for each sequence (and alignments): >> VIMSS3630569 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.7 0.1 1.8e-20 1.8e-20 47 111 .] 19 82 .. 1 82 [. 0.81 2 ! 2.8 0.2 0.0088 0.0088 77 100 .. 94 115 .. 90 124 .. 0.59 Alignments for each domain: == domain 1 score: 59.7 bits; conditional E-value: 1.8e-20 DUF805 47 llvlillvvlalllpslavtvRRlhDigrsgwlillalipiigliilllvllllpgtpgenrYGp 111 l+ i++++++ + +++ t+RRlhD++ +gwl ll+l+p++ +i l ++l++ +gt+g+n YGp VIMSS3630569 19 GLICIAILYIVGIYINFVFTIRRLHDRNNTGWLSLLMLVPVV-NIGLAIYLFCAKGTEGPNDYGP 82 4455566666666789**************************.9999*****************8 PP == domain 2 score: 2.8 bits; conditional E-value: 0.0088 DUF805 77 gwlillalipiigliilllvllll 100 gw i +alip+ li+ ++ +++ VIMSS3630569 94 GW-IYIALIPLA-LIFGVIAVIMA 115 56.456777776.44444434333 PP
Or compare VIMSS3630569 to CDD or PaperBLAST