VIMSS3630635 has 110 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.3e-34 102.7 0.2 5.1e-34 102.5 0.2 1.0 1 VIMSS3630635
Domain annotation for each sequence (and alignments):
>> VIMSS3630635
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 102.5 0.2 5.1e-34 5.1e-34 2 87 .. 11 96 .. 10 98 .. 0.97
Alignments for each domain:
== domain 1 score: 102.5 bits; conditional E-value: 5.1e-34
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeei 87
++pkFq++v+k++ ++++lt+i+lv+Y++f+llv++++++l + g++t+gi+lgl+++vl+f+l+g+Y+++An+++D+l+ee
VIMSS3630635 11 RNPKFQKMVKKKSALSWTLTIIMLVLYVGFMLLVGYNKEFLMSSFSGGVTTWGIPLGLGIIVLSFLLCGVYSYIANNTLDQLSEEA 96
79********************************************88**********************************9985 PP
Or compare VIMSS3630635 to CDD or PaperBLAST