VIMSS363747 has 125 amino acids
Query: DUF1425 [M=96]
Accession: PF07233.16
Description: Protein of unknown function (DUF1425)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-30 91.0 0.0 2.1e-30 90.8 0.0 1.0 1 VIMSS363747
Domain annotation for each sequence (and alignments):
>> VIMSS363747
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 90.8 0.0 2.1e-30 2.1e-30 1 95 [. 31 124 .. 31 125 .] 0.98
Alignments for each domain:
== domain 1 score: 90.8 bits; conditional E-value: 2.1e-30
DUF1425 1 qelvidssvlasrvsveelktrrsngllrasvvlenksktdltlqYrFyWyDedGlevepeaepwqsltlhgkesvtlqavapnprAskfrlyvr 95
q+lv++ss la+++s+e++ ++ s+ + as++++n++++++t++YrFyWyD++Gle++p e +s+t+++++ vtl + a+ A+k+rly++
VIMSS363747 31 QSLVMESSLLAAGISAEKPVLSTSDIQPSASSTIYNERQEPVTVHYRFYWYDARGLEMHPL-ERPRSVTIPAHSAVTLYGSANFLGAHKVRLYLY 124
789*********************************************************9.*******************************97 PP
Or compare VIMSS363747 to CDD or PaperBLAST