VIMSS3651411 has 383 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-35 107.6 0.9 3.8e-35 107.1 0.9 1.2 1 VIMSS3651411 Domain annotation for each sequence (and alignments): >> VIMSS3651411 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.1 0.9 3.8e-35 3.8e-35 2 142 .. 239 374 .. 238 377 .. 0.93 Alignments for each domain: == domain 1 score: 107.1 bits; conditional E-value: 3.8e-35 EryCIII-like_C 2 avldqvaelDaEivvaldedarpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivls 96 +vld++ +l aE+v+a +p +++ p + ++++Pl+ +l +c+a+vHhgG+g++ltal +G+Pq+v+p++ d++v+a r+ l + vl+ VIMSS3651411 239 RVLDAAHRLGAEVVLA---ADEPPVESHPALLA-AGRLPLDQVLASCDALVHHGGSGTMLTALCHGLPQLVFPHGSDHFVNADRLRSLHLAAVLN 329 79**************...55677888888777.999****************************************************999997 PP EryCIII-like_C 97 kdeltsdsiakavaevvedpayraaaaklaeeiaaePsPtEvakkl 142 +++ +++++++ v+ d+ ra++ k+a+eiaa+P+P+++++ VIMSS3651411 330 A-RDDPTRVERTLHAVLTDEGMRAGTRKIADEIAAQPAPADLVPLF 374 6.5799**********************************999765 PP
Or compare VIMSS3651411 to CDD or PaperBLAST