VIMSS3654316 has 392 amino acids
Query: EryCIII-like_C [M=145]
Accession: PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.7e-20 57.6 0.1 1.4e-19 56.6 0.1 1.5 1 VIMSS3654316
Domain annotation for each sequence (and alignments):
>> VIMSS3654316
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 56.6 0.1 1.4e-19 1.4e-19 23 127 .. 268 372 .. 257 377 .. 0.93
Alignments for each domain:
== domain 1 score: 56.6 bits; conditional E-value: 1.4e-19
EryCIII-like_C 23 rpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpa 117
++l++ p n + + P ++l ++++++ h+G st+ +l +GvP v +p+ ++a++a rv elG g l +de+t++++++av++v +d+
VIMSS3654316 268 VSELGQAPANFEVRESFPQLAVLRQASVFLSHTGMNSTMESLYYGVPLVAVPQMPEQALNAARVEELGLGRRLVTDEVTAEQLRAAVEQVSGDED 362
57889999999888********************************************************************************* PP
EryCIII-like_C 118 yraaaaklae 127
ra+ a +++
VIMSS3654316 363 VRANLADMQR 372
***9988876 PP
Or compare VIMSS3654316 to CDD or PaperBLAST