VIMSS369206 has 155 amino acids
Query: DUF6691 [M=142] Accession: PF20398.2 Description: Family of unknown function (DUF6691) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-55 172.9 9.3 2.8e-55 172.7 9.3 1.0 1 VIMSS369206 Domain annotation for each sequence (and alignments): >> VIMSS369206 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 172.7 9.3 2.8e-55 2.8e-55 5 138 .. 6 139 .. 1 143 [. 0.97 Alignments for each domain: == domain 1 score: 172.7 bits; conditional E-value: 2.8e-55 DUF6691 5 mallvgllfglglivsgltdpakvigfldlagawdpslafvmggailvglvafrlarkrdksllgaplrlpaatdidrrlvlgslafgagwglagfcp 102 all gl+fglgli+sg+tdpakv++fld+ag wdpsl fvm gai +g afr a++r ++ll +p+ lp + ++d rl+lgsl fg+gwgl g cp VIMSS369206 6 TALLSGLVFGLGLILSGMTDPAKVLSFLDVAGLWDPSLMFVMLGAISIGFFAFRAAKRRGRTLLSTPVHLPGTRTVDLRLILGSLLFGMGWGLVGICP 103 689*********************************************************************************************** PP DUF6691 103 gpalaslasggskplifvaamlagmalfellerlaa 138 gp l asg ++ ++f+ aml gm +f+ le+ ++ VIMSS369206 104 GPGLVLAASGHTGGIVFMVAMLLGMFIFDRLEKHRQ 139 ********************************9887 PP
Or compare VIMSS369206 to CDD or PaperBLAST