VIMSS3706089 has 55 amino acids
Query: VraX [M=55]
Accession: PF17412.6
Description: Family of unknown function
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-44 135.5 1.3 2.1e-44 135.4 1.3 1.0 1 VIMSS3706089
Domain annotation for each sequence (and alignments):
>> VIMSS3706089
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 135.4 1.3 2.1e-44 2.1e-44 1 55 [] 1 55 [] 1 55 [] 0.99
Alignments for each domain:
== domain 1 score: 135.4 bits; conditional E-value: 2.1e-44
VraX 1 miiYRryieeGaPvYeiitktFktvsikCDesFsdteiykLLsLLedDvDnmkvs 55
miiYR+y++eGaPvYeiitktF++vsikCD+sFsdtei+kLLsLL+dD+D+mkvs
VIMSS3706089 1 MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLLQDDIDHMKVS 55
9*****************************************************8 PP
Or compare VIMSS3706089 to CDD or PaperBLAST