VIMSS3706187 has 214 amino acids
Query: DUF402 [M=68] Accession: PF04167.18 Description: Protein of unknown function (DUF402) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-19 56.3 0.2 2.9e-19 55.4 0.2 1.5 1 VIMSS3706187 Domain annotation for each sequence (and alignments): >> VIMSS3706187 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.4 0.2 2.9e-19 2.9e-19 1 68 [] 61 128 .. 61 128 .. 0.94 Alignments for each domain: == domain 1 score: 55.4 bits; conditional E-value: 2.9e-19 S-EEEEE-TT-SEEEEEEEETTTEEEEEEEEEES--EE..E.EEE-EEEEEEESEEE......-HHHH CS DUF402 1 dlalwllplgewynvtkfldedgrfkgwYvniatppergegtvkyiDldLDvvvypdgevevlDedEl 68 +++l++lp++++y++t+++d +g+ +++Y++i+ + +g+ ++Dl LDv p+ge+e++Ded+l VIMSS3706187 61 YKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNACTVDLCLDVLALPSGEYELVDEDDL 128 689*******************************96665599************************97 PP
Or compare VIMSS3706187 to CDD or PaperBLAST