PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3706187 to PF04167 (DUF402)

VIMSS3706187 has 214 amino acids

Query:       DUF402  [M=68]
Accession:   PF04167.18
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.5e-19   56.3   0.2    2.9e-19   55.4   0.2    1.5  1  VIMSS3706187  


Domain annotation for each sequence (and alignments):
>> VIMSS3706187  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   55.4   0.2   2.9e-19   2.9e-19       1      68 []      61     128 ..      61     128 .. 0.94

  Alignments for each domain:
  == domain 1  score: 55.4 bits;  conditional E-value: 2.9e-19
                   S-EEEEE-TT-SEEEEEEEETTTEEEEEEEEEES--EE..E.EEE-EEEEEEESEEE......-HHHH CS
        DUF402   1 dlalwllplgewynvtkfldedgrfkgwYvniatppergegtvkyiDldLDvvvypdgevevlDedEl 68 
                   +++l++lp++++y++t+++d +g+ +++Y++i+  +   +g+  ++Dl LDv   p+ge+e++Ded+l
  VIMSS3706187  61 YKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNACTVDLCLDVLALPSGEYELVDEDDL 128
                   689*******************************96665599************************97 PP



Or compare VIMSS3706187 to CDD or PaperBLAST