VIMSS3713643 has 98 amino acids
Query: DUF167 [M=76]
Accession: PF02594.20
Description: Uncharacterised ACR, YggU family COG1872
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-27 82.3 0.0 1.3e-27 82.1 0.0 1.1 1 VIMSS3713643
Domain annotation for each sequence (and alignments):
>> VIMSS3713643
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 82.1 0.0 1.3e-27 1.3e-27 1 70 [. 12 78 .. 12 85 .. 0.91
Alignments for each domain:
== domain 1 score: 82.1 bits; conditional E-value: 1.3e-27
DUF167 1 gvllavrvkPgakkdaigeeeaegrealkvrvaappvdGkANaaliefLakalgvpksdveivsGetsre 70
g++l++ ++P+a++d+i+ ++++lk++++appvdG+ANa+l+++L+k+++vpks++ +++Ge +r+
VIMSS3713643 12 GIRLRIFLQPKASRDQIV---GLHDSELKIAITAPPVDGAANAHLLKYLSKLFKVPKSSIVLEKGELQRH 78
689***************...567788***************************************9986 PP
Or compare VIMSS3713643 to CDD or PaperBLAST