PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS37400 to PF04167 (DUF402)

VIMSS37400 has 176 amino acids

Query:       DUF402  [M=68]
Accession:   PF04167.18
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.5e-24   71.6   2.0    4.5e-24   70.8   2.0    1.4  1  VIMSS37400  


Domain annotation for each sequence (and alignments):
>> VIMSS37400  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   70.8   2.0   4.5e-24   4.5e-24       2      68 .]      60     124 ..      59     124 .. 0.95

  Alignments for each domain:
  == domain 1  score: 70.8 bits;  conditional E-value: 4.5e-24
                 -EEEEE-TT-SEEEEEEEETTTEEEEEEEEEES--EE..E.EEE-EEEEEEESEEE......-HHHH CS
      DUF402   2 lalwllplgewynvtkfldedgrfkgwYvniatppergegtvkyiDldLDvvvypdgevevlDedEl 68 
                 +a+++++  +w+nv+ +l+e  +++++Y+ni++p  ++ +++kyiD+dLDv+v+pd+++++lDedE+
  VIMSS37400  60 PAICYFHARQWFNVIGMLRE--DGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEY 124
                 799*****************..7***********7776699*************************7 PP



Or compare VIMSS37400 to CDD or PaperBLAST