VIMSS37400 has 176 amino acids
Query: DUF402 [M=68]
Accession: PF04167.18
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-24 71.6 2.0 4.5e-24 70.8 2.0 1.4 1 VIMSS37400
Domain annotation for each sequence (and alignments):
>> VIMSS37400
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.8 2.0 4.5e-24 4.5e-24 2 68 .] 60 124 .. 59 124 .. 0.95
Alignments for each domain:
== domain 1 score: 70.8 bits; conditional E-value: 4.5e-24
-EEEEE-TT-SEEEEEEEETTTEEEEEEEEEES--EE..E.EEE-EEEEEEESEEE......-HHHH CS
DUF402 2 lalwllplgewynvtkfldedgrfkgwYvniatppergegtvkyiDldLDvvvypdgevevlDedEl 68
+a+++++ +w+nv+ +l+e +++++Y+ni++p ++ +++kyiD+dLDv+v+pd+++++lDedE+
VIMSS37400 60 PAICYFHARQWFNVIGMLRE--DGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEY 124
799*****************..7***********7776699*************************7 PP
Or compare VIMSS37400 to CDD or PaperBLAST