PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3782399 to PF09186 (DUF1949)

VIMSS3782399 has 200 amino acids

Query:       DUF1949  [M=56]
Accession:   PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.7e-10   27.0   0.1    2.6e-10   26.4   0.1    1.3  1  VIMSS3782399  


Domain annotation for each sequence (and alignments):
>> VIMSS3782399  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.4   0.1   2.6e-10   2.6e-10       1      56 []     139     194 ..     139     194 .. 0.97

  Alignments for each domain:
  == domain 1  score: 26.4 bits;  conditional E-value: 2.6e-10
       DUF1949   1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56 
                   l+ dY+  + +++l   +g++i  e+Y+d++  ++ + +++   f +++ ++t G+
  VIMSS3782399 139 LEYDYSETANVENLANRYGIQIIKENYSDNISKIIKIVASDKYMFLEEIKNITKGK 194
                   678***************************************************97 PP



Or compare VIMSS3782399 to CDD or PaperBLAST