VIMSS3782399 has 200 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-10 27.0 0.1 2.6e-10 26.4 0.1 1.3 1 VIMSS3782399
Domain annotation for each sequence (and alignments):
>> VIMSS3782399
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 26.4 0.1 2.6e-10 2.6e-10 1 56 [] 139 194 .. 139 194 .. 0.97
Alignments for each domain:
== domain 1 score: 26.4 bits; conditional E-value: 2.6e-10
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56
l+ dY+ + +++l +g++i e+Y+d++ ++ + +++ f +++ ++t G+
VIMSS3782399 139 LEYDYSETANVENLANRYGIQIIKENYSDNISKIIKIVASDKYMFLEEIKNITKGK 194
678***************************************************97 PP
Or compare VIMSS3782399 to CDD or PaperBLAST