PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3789699 to PF01817 (CM_2)

VIMSS3789699 has 88 amino acids

Query:       CM_2  [M=79]
Accession:   PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.5e-26   79.0   1.1    1.7e-26   78.8   1.1    1.0  1  VIMSS3789699  


Domain annotation for each sequence (and alignments):
>> VIMSS3789699  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   78.8   1.1   1.7e-26   1.7e-26       1      79 []       7      84 ..       7      84 .. 0.95

  Alignments for each domain:
  == domain 1  score: 78.8 bits;  conditional E-value: 1.7e-26
          CM_2  1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
                  R+eI++iD+el+ Ll++Rm+l+ ++a+yK+e+g++vld++Ree +l r++++  e+  +++++ + f++i+++sra+Q+
  VIMSS3789699  7 RQEINQIDDELVVLLEKRMNLVNQVAAYKQETGKAVLDTKREEVILGRVADH-VENPAYKDTILATFKDILKNSRAYQE 84
                  9**************************************************3.3556*********************6 PP



Or compare VIMSS3789699 to CDD or PaperBLAST