VIMSS3819980 has 77 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.4e-20 56.5 2.1 1.2e-19 56.1 2.1 1.2 1 VIMSS3819980
Domain annotation for each sequence (and alignments):
>> VIMSS3819980
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 56.1 2.1 1.2e-19 1.2e-19 1 37 [] 32 68 .. 32 68 .. 0.97
Alignments for each domain:
== domain 1 score: 56.1 bits; conditional E-value: 1.2e-19
DUF1127 1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdir 37
+++ l++Wr +R+t+ eL+r+sDreL+D+G+ R+dir
VIMSS3819980 32 IARSLTNWRKYRQTVTELGRMSDRELNDLGIGRQDIR 68
5899********************************8 PP
Or compare VIMSS3819980 to CDD or PaperBLAST