VIMSS42699 has 190 amino acids
Query: DUF697 [M=162]
Accession: PF05128.16
Description: Domain of unknown function (DUF697)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-18 53.2 0.3 1.9e-18 52.9 0.3 1.3 1 VIMSS42699
Domain annotation for each sequence (and alignments):
>> VIMSS42699
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 52.9 0.3 1.9e-18 1.9e-18 20 104 .. 23 104 .. 7 161 .. 0.75
Alignments for each domain:
== domain 1 score: 52.9 bits; conditional E-value: 1.9e-18
DUF697 20 reakkliekyawekAlvvavsPlalvDllavaavnlrmirelaelYgielgyesairLarsvlanlaalGavelgtdllkqllsl 104
+e + + k+a+ +++vav P++++D+l+++ v+++m+ +++++Yg+ ++ e+ ++++++++a+la+ G+ ++ +++ ++++l
VIMSS42699 23 EENIEEVIKSAALLSGAVAVEPIPFADMLLITPVQAKMVLHIGKIYGFDITPERGREIVQELGATLAY-GM--VARQVMRGVAKL 104
444556678888999**************************************************997.33..334444444444 PP
Or compare VIMSS42699 to CDD or PaperBLAST