PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS46225 to PF04301 (BioG)

VIMSS46225 has 203 amino acids

Query:       BioG  [M=213]
Accession:   PF04301.17
Description: Pimeloyl-ACP methyl esterase BioG
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.2e-28   85.4   0.0    2.5e-28   85.2   0.0    1.1  1  VIMSS46225  


Domain annotation for each sequence (and alignments):
>> VIMSS46225  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   85.2   0.0   2.5e-28   2.5e-28       8     211 ..      10     201 ..       1     203 [] 0.81

  Alignments for each domain:
  == domain 1  score: 85.2 bits;  conditional E-value: 2.5e-28
        BioG   8 qqgdnlilyfagwgtppdvvehlilpenydlllcydyrdlnldvdfsayrhirlvawsmgvwvaervlqgirlksatavngtglpcddqygipeavfkg 106
                  + ++li+ f g+ +  +   hl    + +++l ydy++++l++df a+  + l+a+smgv va+r l+ +++k   a+ngt l  d   gi  a+f+ 
  VIMSS46225  10 PDSKKLIVVFGGFASHSSHFSHLK--SDKNVILFYDYENFDLNFDFKAFDELFLIAFSMGVCVANRLLKELNFKQKIAINGTNLGIDKSKGIHPAIFRK 106
                 35678****************986..5566899****************************************************************** PP

        BioG 107 tlenltedtrlkferric.gdkalledyqqysarptlqeihaelialyallqqdrrtdlirwskalvgskdkifmaanqraywtdrcavreidvehllf 204
                 tl+n++ ++   f+  +    k l +d+     +    +i  e +  +al++q+     + w k     kd if+++  ++ +++   +   +  h+ f
  VIMSS46225 107 TLQNFKLEN---FKEALFkERKNLTKDFIFKDEKA--LKIELEKLFDFALVKQEE---NLLWDKVYSSKKDEIFPPNALKNAFSKLIFL---NEPHFAF 194
                 ****98776...44444404466666665444444..345555556667777764...467***************9999988876655...5589999 PP

        BioG 205 srfthwe 211
                  +f  w+
  VIMSS46225 195 FHFKTWD 201
                 9999997 PP



Or compare VIMSS46225 to CDD or PaperBLAST